SKU: 26074394227

Human ANGPTL3,His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human ANGPTL3,His tagProduct Specification Species Human Synonyms Angiopoietin related protein 3, Angiopoietin 5 (ANG 5), Angiopoietin like protein 3, ANGPT5 Accession Q9Y5C1 Amino Acid Sequence Protein sequence(Q9Y5C1, Ser17 Glu460, with C 10*His)

Product Specification


Species Human
Synonyms Angiopoietin-related protein 3, Angiopoietin-5 (ANG-5), Angiopoietin-like protein 3, ANGPT5
Accession Q9Y5C1
Amino Acid Sequence

Protein sequence(Q9Y5C1, Ser17-Glu460, with C-10*His) SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFEGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:53.4kDa Actual:70kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Angiopoietin-like 3, also known as ANGPTL3, is a member of the angiopoietin-like family of secreted factors. It is expressed predominantly in the liver, and has the characteristic structure of angiopoietins, consisting of a signal peptide, N-terminal coiled-coil domain, and the C-terminal fibrinogen (FBN)-like domain. The FBN-like domain in angiopoietin-like 3 protein was shown to bind alpha-5/beta-3 integrins, and this binding induced endothelial cell adhesion and migration. This protein may play a role in the regulation of angiogenesis. ANGPTL3 also acts as dual inhibitor of lipoprotein lipase (LPL) and endothelial lipase (EL),[7] thereby increasing plasma triglyceride, LDL cholesterol and HDL cholesterol in mice and humans.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 26074394227

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
Peter
Louisville, US
★★★★★ 5
Great socks, watch out for bad seller
Number of Items: 6, Color: Black (6-pairs), Size: Medium
The socks are great, comfy, padded where you want it. I used these for work socks; I have a blend of corporate desk life and maintenance work. I like the low cut so my shoes don't rub the back of my ankle but not so high that socks always fall down. Great for running and sports as well. Been using these for years. Buyer beware though of the particular seller Liegnitz Group: They were late shipping, sent me the wrong socks so I sent for a return and they send me the right ones. My return got delivered back to them but they did not process it and did not send out any new ones. They cancelled my order and acted like I got the right ones all along. Buy from a different retailer.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 8, 2024
T
Verified Purchase
Terry Hale
Pawtucket, US
★★★★★ 5
Comfortable with perfect fit
Number of Items: 6, Color: White (6-pairs), Size: Medium
I have had these socks for a few weeks now and wear them when running. I have small feet at a men's size 7 and they fit perfectly. Most men's socks are to big for my feet. They are pretty thin but well made and have good cushion. I recommend these for anyone that likes ankle socks for athletic activities.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2024
N
Verified Purchase
Notimpressed
Dallas, US
★★★★★ 4
Husband loves socks
Number of Items: 6, Color: Black (6-pairs), Size: Large
Socks are very comfortable and soft. He got rid of the other ones he had! Also, it was a great price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 9, 2024
P
Verified Purchase
pena_89
San Leandro, US
★★★★★ 5
Good product
Number of Items: 6, Color: Black (6-pairs), Size: Large
Good fit, item as advertised!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
K
Verified Purchase
Keith
Lake Worth, US
★★★★★ 5
Great socks
Number of Items: 6, Color: Black (6-pairs), Size: Medium
I love these socks
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026

recommand products