SKU: 50470267750

Human MUC5AC , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 21 - Jul 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human MUC5AC , His tagProduct Specification Species Human Synonyms Gastric mucin, Major airway glycoprotein, Mucin 5 subtype AC, tracheobronchial, Tracheobronchial mucin, TBM Accession P98088 Amino Acid Sequence Protein sequence(P98088, Thr1850 Cys1950, with C 10*His) TSTPGSTSSSPAQTTPSTTSKTTETQASGSSAPSSTPGTVSLSTARTTPAPGTATSVKKTFSTPSPPPVPATSTSSMSTTAPGTSVVSSKPTPTEPSTSSCGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 11. 3kDa Actual: 20 120kDa Purity

Product Specification


Species Human
Synonyms Gastric mucin, Major airway glycoprotein, Mucin-5 subtype AC, tracheobronchial, Tracheobronchial mucin, TBM
Accession P98088
Amino Acid Sequence

Protein sequence(P98088, Thr1850-Cys1950, with C-10*His) TSTPGSTSSSPAQTTPSTTSKTTETQASGSSAPSSTPGTVSLSTARTTPAPGTATSVKKTFSTPSPPPVPATSTSSMSTTAPGTSVVSSKPTPTEPSTSSCGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:11.3kDa Actual:20-120kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

MUC-5AC is a large gel-forming glycoprotein. In the respiratory tract it protects against infection by binding to inhaled pathogens that are subsequently removed by mucociliary clearance. Overproduction of MUC-5AC can contribute to diseases such as asthma and chronic obstructive pulmonary disease, and has also been associated with greater protection against influenza infection. This protein has been linked to mucus hypersecretion in the respiratory tract and is associated to chronic obstructive pulmonary disease (COPD).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 50470267750

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
LindyB
San Leandro, US
★★★★★ 5
Great dressy sneaker to wear with business casual or jeans
Size: 11, Color: British Tan/Ivry
I got these for my husband to wear with jeans or business casual dress pants. They look sharp and professional and dress up jeans if you're going out. He says they fit comfortably and he can walk on them all day without his feet hurting. They are beautiful genuine leather so they don't get stinky. I got my husband's normal size and they fit to size.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 11, 2026
T
Verified Purchase
timothy scalabrelli
Whiting, US
★★★★★ 4
Comfortable
Size: 9, Color: Black/Ivory
Most comfortable and roomy shoes I ever wore. Great for insoles. Looks nice too. The base of the shoe is a bit too thick but it’s fine.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 5, 2025
A
Verified Purchase
Ashley
Natrona Heights, US
★★★★★ 5
⭐️⭐️⭐️⭐️⭐️ Comfort, Style, and Performance — Perfect for Daily Runs and All-Day Wear!
Size: 11, Color: Black/Dark Smoke Grey
I purchased the Nike Men’s Quest 6 for my son, and he’s been absolutely thrilled with them. From the moment he put them on, he noticed how lightweight and supportive they felt — a great balance between cushioning and responsiveness. He wears them both for running and casual outings, and they’ve held up beautifully. The breathable mesh upper keeps his feet cool even during longer runs, and the midsole cushioning absorbs impact nicely without feeling too soft or unstable. The grip on the outsole provides solid traction on roads and gym floors, giving confidence with every step. Design-wise, they look sleek and modern — the classic Nike styling pairs well with both athletic and casual outfits. After several weeks of use, the shoes still look almost new, showing how well they’re built. Pros: ✅ Lightweight yet supportive — great for running or walking ✅ Comfortable fit right out of the box ✅ Excellent breathability and cushioning ✅ Durable construction that holds up with daily use ✅ Stylish design that transitions easily from workout to casual wear Cons: • Runs slightly narrow, so consider sizing up if between sizes Overall, the Nike Quest 6 offers exceptional comfort and quality for the price. My son says they’re some of the most comfortable shoes he’s ever worn — perfect for both training and everyday wear. If you’re looking for a reliable running shoe that combines performance, durability, and style, this is an excellent choice.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 5, 2025
K
Verified Purchase
KC
Houston, US
★★★★★ 5
Excellent Running Shoe
Size: 11, Color: Black/University Red/White
The Nike Quest 6 has been a great fit right out of the box. The sizing felt true, and the shoe wrapped comfortably without feeling tight or loose. It was easy to get a secure, natural fit from the first wear. Quality is solid for everyday use. The materials feel well put together, and the shoe holds up nicely for walking and light running. It feels dependable and comfortable for regular wear. What really stood out was the value. The price was much better than what I saw in retail stores, especially for a Nike shoe that performs this well. It’s an easy way to get a reliable running shoe without paying full store pricing. Overall, it’s a comfortable, well-made shoe that delivers a lot for the cost.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
S
Verified Purchase
StephanieS
Fort Morgan, US
★★★★★ 5
Good product
Size: 9, Color: Black/Dark Smoke Grey
Great shoes and they seem to have good support qualities. They are super comfortable and I love the all black coloring and it is good for my job to look professional.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026

recommand products