SKU: 91914050242

Human CD36, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD36, His tagProduct Specification Species Human Synonyms Fatty acid translocase (FAT), Glycoprotein IIIb (GPIIIB), Leukocyte differentiation antigen CD36, PAS IV, PAS 4, Platelet collagen receptor, Platelet glycoprotein IV (GPIV), Thrombospondin receptor, GP3B, GP4 Accession P16671 Amino Acid Sequence Protein sequence (P16671, Gly30 Asn439, with C 10*His)

Product Specification


Species Human
Synonyms Fatty acid translocase (FAT), Glycoprotein IIIb (GPIIIB), Leukocyte differentiation antigen CD36, PAS IV, PAS-4, Platelet collagen receptor, Platelet glycoprotein IV (GPIV), Thrombospondin receptor, GP3B, GP4
Accession P16671
Amino Acid Sequence

Protein sequence (P16671, Gly30-Asn439, with C-10*His) GDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 48.3 kDa Observed MW: 72-95 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD36 (cluster of differentiation 36), also known as platelet glycoprotein 4, fatty acid translocase (FAT), scavenger receptor class B member 3 (SCARB3), and glycoproteins 88 (GP88), IIIb (GPIIIB), or IV (GPIV) is a protein that in humans is encoded by the CD36 gene. The CD36 antigen is an integral membrane protein found on the surface of many cell types in vertebrate animals. It imports fatty acids inside cells and is a member of the class B scavenger receptor family of cell surface proteins. CD36 binds many ligands including collagen, thrombospondin, erythrocytes parasitized with Plasmodium falciparum, oxidized low density lipoprotein, native lipoproteins, oxidized phospholipids, and long-chain fatty acids. Work in genetically modified rodents suggest a role for CD36 in fatty acid metabolism, heart disease, taste, and dietary fat processing in the intestine. It may be involved in glucose intolerance, atherosclerosis, arterial hypertension, diabetes, cardiomyopathy, Alzheimer's disease and various cancers, mostly of epithelial origin (breast, prostate, ovary, and colon) and also for hepatic carcinoma and gliomas.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 91914050242

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Joe
Charlottesville, US
★★★★★ 5
Great chair - great customer service from seller
Color: Matte-black
Good chair for home office. Easy to assemble and comfortable to use. I was concerned when it arrived as the bottom of the box had gotten wet and damaged during shipment. But the only issue was the frame for the footrest had rusted in a couple places. I contacted the company, sent pictures and in a couple of days they shipped back the complete footrest already assembled. Great customer service and so far a great chair.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 22, 2026
A
Verified Purchase
AJ
Grantham, US
★★★★★ 5
Very Impressed
First off, I just want to say that this is a very good company. They have the best customer service that I have seen with any online company that I have ever dealt with. Other companies should take notes on how they should handle problems from this company. Now On to my review of this chair. I purchased the chair almost 5 months ago now and was pretty hyped about getting it. It is not very easy to find a chair for a larger person. I weigh 299 pounds and needed something that would support that. Some of the other office chairs I have had in the past said that they did support up to and over my weight and the gas cylinder would always give out. So far, I have not had any issues with it. Now I did have a few problems with the chair, and the company fixed the problem right away. The first was comfort. When I first got the chair, it was kind of stiff which is expected of a new chair. But the wings on the side of it would rub on my legs making it painful to sit in the chair for more than an hour. It seemed that the metal bars in it were too far pressed in. I contacted the company about it to see what they could do to fix the problem and they sent me out a cushion to help raise me above the cushion. That was good enough for me. Eventually I ended up not having to use the cushion. (I was working on losing weight.) They second problem happened with the wheel base. One of the supports that held the wheels in place had come apart. I contacted the company right away and sent them a picture of the problem and they sent me out a new base. Not the easiest to change out once you have set it in place. But after watching videos on YouTube I was able to get it replaced. Now 4 months later I did have another issue with the chair which actually happened to me 1 week ago now from this date. My arm rests were moving around a lot and I didn't understand why. So, I flipped the chair over to check and see if the screws had come loose. They were not loose at all. I then went ahead and took the arm rests off and as soon as I did I noticed a metal bar had fallen. I removed the felt that was hiding it and seen that the welds that held the bar in place had failed. I am not going to lie I was pretty bummed about it. I contacted the company and explained to them what happened, I sent in pictures to show the problem. They got back to me within hours of my complaint and sent me out another seat to replace the old one. I just got it 2 days ago and put it on and all is good again. Now one thing I noticed about the new chair seat is that the metal bars are not sticking in my side. Either I have lost weight (I have.) or they have fixed that problem. Either way I am completely happy. Now I am sure that there are other chairs out there that are a bit better in comfort but they also cost a lot more. This is a very nice chair for anyone looking to get a gaming office chair and not break the bank in the process. Just a few pros and cons about the chair. Pros: 1. Great Customer Service from the company. They actually uphold a warranty. 2. Affordable price for a gaming office chair. 3. The recline feature comes in handy and is really nice. Cons: 1. The arm rests should be a bit higher or be able to extend higher then what is allowed currently. 2. Not the most comfortable chair if you sit in it for extended times. More cushion could help this problem. Overall, I am really happy with my purchase and would recommend and use this company again in the future. I hope that someone finds this review helpful when going to purchase a affordable office chair.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 7, 2018
K
Verified Purchase
KC
Los Angeles, US
★★★★★ 5
A no-brainer.
Color: Earth-black
Impressed! The shipping took less than 3 days when it showed 7-8 days. Cool. The box showed up at my door. It's pretty big & quite heavy, prolly not for grannies to pull inside (which usually means at least decent quality, right? ~80-ish lbs, maybe?). Opened the box & it looks more complicated than it is. Parts. And parts. And more parts. But VERY straightforward & simple, even for those less mechanically inclined (not me, thank gawd). I read the 1st panel on the instructions, & it made perfect sense, so I traded out their supplied tool for one on my drill. Zip. Zip. Zip. It's all put together & sitting in it in 42 minutes. Comfortable. Relaxing. Sturdy. Pretty high of a lift. Tall back. Make sure you have enough room for this, it's substantial. I have a feeling I'll be spending some nights zonked out in this. Hope it lasts. Whoever designed this made it super easy. Even a caveman could do it! Thank you, China! (I waited 'til it was on sale for abt $160-ish. Yes, even w/ these ~eyeroll~ tariffs.). Worth it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 21, 2026
Y
Verified Purchase
ye huaxiang
New York, US
★★★★★ 5
Perfect Study Chair for Kids – Comfortable, Soft and My Child Loves It!
Color: Pink, Color: Pink
I bought this pink chair for my child to use while studying, and it has been a great purchase. The chair is very comfortable and soft, with a thick cushion and supportive backrest, so my child can sit for a long time while doing homework without feeling tired. The ergonomic design is really nice as well. The backrest supports the back very well and helps keep a more natural sitting posture. The armrests are also at a comfortable height, which makes writing and drawing easier. Most importantly, my child absolutely loves this chair. She enjoys sitting here to study, read, and draw. Sometimes she spends quite a while drawing in the chair and seems very comfortable the whole time. The pink color is beautiful and looks very cute in the room. The quality feels good and the wheels roll smoothly, making it easy to move around. Overall, this is a great chair for kids to study, read, or do art, and seeing how much my child enjoys using it makes me very happy with this purchase. Highly recommended!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 12, 2026
A
Verified Purchase
Aurihazuma
Whiting, US
★★★★★ 3
Not the best chair... Had to buy several accessories
Color: Earth-black, Color: Earth-black
I have so much to say that I had to compose in word… The chair was very easy to assemble and came packed with pride and care in a very nice box, but I find the design to be remarkably lacking, and the below stated demonstrates this QED. The suggestion to use the packing box as an assembly table is a nice idea, but the box is too wide by several inches to use in order to attach both arms. The sales ad stated 23.4” is the total width of the cushion, not the average sittable area. The lumbar support is laughable, and really ought to have been made inflatable if they were going to go with this route... I had to go back to my special support cushion. So do not depend on it supporting you if you have a bad back like I do. Secondly… My African-American friends have often said to me something like "Get your narrow little butt over here" because I have almost "No Butt!" - HAH!.. This chair cushion is NOT MADE FOR PEOPLE LIKE ME with no butt... you will need a support cushion; either a memory foam or inflatable. The seat is poorly cushioned with a thin layer set of polyester fiber file on top of rather hard, and possibly memory foam, and is as hard as a stone. (I have decided to get an inflatable cushion for now and my go memory foam, and currently sit on top of my soft memory foam backrest... I have had to spend almost half of the price of the chair to handle upgrades.) To top it all off it also leans forward a bit instead of being properly flat or at least adjustable, and there is no tilt for that or elsewise another kind of adjustment. I feel like I am constantly sliding off of the chair and will have to add shims to the mechanism in order to correct the forward leaning tilt that is bothering me even now as I sit upon my currently only office chair. I cannot sit in this thing without both the foot rest, and my foot stool, and I am still rolling down Lombard Street (Looks that one up folks. It’s in San Francisco). (My last one was so worn out that I had no choice.) The lean (not genuine tilt) of the back is marginally passable, but a mere 150 degrees is not built for relaxing. I am also having to get an even more deeply counter-sunk gas cylinder because this one is too freaking high. Don't listen to those who say the chair is also good for short people. I am 5' 6.5" in height. This already makes it almost impossible to find any furniture to fit me because the majority of people in America seem to be geared for 6' heights. The arms are kind of nice, but the over-all vinyl covering is rather thin. It will not stand up to cats... There is also 35% less space from my last chair for my cat to sit with me without knocking the keyboard off of my lap. I will be purchasing some leather and making an overlay for the armrests as soon as possible. It is... nice to be able to raise and lower the armrests. The casters they give are rather - extremely cheap. I knew this already and had procured some proper roller blade style casters with brakes so they will actually last, and I could lock the movement of the chair, and so they also do not get balled up with fuzz like the ones they sent will. Furthermore... This chair might barely fit a plus sized person, but it is not suitable for large people even with the arms mounted at the widest. I can take my medium-sized hands held flat with pinkies on the arm rests and thumbs on my person and put them down beside my hips and snugly touch the inside of the arm rests and my personage, on either side. Please keep in mind that I am not a large person. I could not find a proper foot rest on any chair out there without adding substantially more to the cost, and also making the chair non-movable, so there went that --and I must make sure to have parts for these current "Walmart style" designs. While not a totally horrid chair, it leaves a lot to be desired and I'm stuck with it now. I give the chair a three-star rating, and hope I can stand to use it once I get the last of the accessories that now total almost half the price of the chair… Namaste.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026

recommand products